Journal: Cell

Article Title: Structure of the MIND Complex Defines a Regulatory Focus for Yeast Kinetochore Assembly

doi: 10.1016/j.cell.2016.10.011

Figure Lengend Snippet: KEY RESOURCES TABLE

Article Snippet: REAGENT or RESOURCE SOURCE IDENTIFIER Chemicals, Peptides, and Recombinant Proteins Dsn1 560-572 QQLLKGLSLSFSK Tufts University Core Facility N/A FITC-Dsn1 560-572 FITC-AHA-QQLLKGLSLSFSK Tufts University Core Facility N/A Mtw1 230-262 KDFRTRYIDIRTNNVLRKLGLLGDKEDEKQSAK Tufts University Core Facility N/A FITC-Mtw1 230-262 FITC-AHA-KDFRTRYIDIRTNNVLRKLGLLGDKEDEKQSAK Tufts University Core Facility N/A Mtw1 274-289 SIDIEEPQLDLLDDVL Tufts University Core Facility N/A FITC-Mtw1 274-289 FITC-AHA- SIDIEEPQLDLLDDVL Tufts University Core Facility N/A FITC-Mif2 1-41 MDYMNLGVKSRKTGLTVNKTVQKDEYSMENLNDFFKDEQDS Tufts University Core Facility N/A FITC-Ame1 1-25 MDALKQRHLKLLYRQRGSASRTIDY Tufts University Core Facility N/A PEG 550 MME Hampton Research HR2-611 PGA-LM Molecular Dimensions MD2-250-108 Ethylmercurithiosalicylic acid, sodium salt Heavy Atom Screen M1 Hampton Research HR2-448 L(+)-Selenomethionine Acros Organics 3211-76-5 PEG 8000 Sigma 81268-1kg Tantalum Cluster Derivatization Kit Jena Bioscience PK-103 PEG 3000 Rigaku 1008057 Deposited Data Atomic coordinates, MIND-C1 structure Protein Data Bank PDB: 5T58 Atomic coordinates, MN-C2 structure Protein Data Bank PDB: 5T51 Atomic coordinates, MN-C2-Mif2 1-41 structure Protein Data Bank PDB: 5T59 Atomic coordinates, Spc24/Spc25-Dsn1 560-572 structure Protein Data Bank PDB: 5T6J Experimental Models: Organisms/Strains E. coli Rosetta 2 (DE3) EMD #71400 Recombinant DNA pLIC_M42 H 6 -TEV- *MIND-C1 This study N/A pLIC_M147 H 6 -TEV- *MIND-C1:D205 This study N/A pLIC_M147_mut2 H 6 -TEV- *MIND-C1:D205-2D This study N/A pLIC_M142 H 6 -TEV- *MIND-C1:D367 This study N/A pLIC_M89 H 6 -TEV- *head I MN-C2 This study N/A pLIC_M89_mut4 H 6 -TEV- *head I Site II mut.

Techniques: Recombinant, Software